PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 491aa    MW: 54940.3 Da    PI: 7.7084
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615390.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.34.9e-3176133260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDg++WrKYGqK vkgs+fprsYY+Ct+++Cpv+kkve++  +++v+ei+Y+g Hnh+k
  XP_009615390.1  76 DDGFTWRKYGQKRVKGSNFPRSYYKCTQQSCPVRKKVECAP-NGQVIEIVYNGAHNHPK 133
                     8****************************************.***************85 PP

2WRKY102.62.3e-32284341259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vkg+++prsYY+Ct agC v+k+ver++++ k v++tYeg+Hnhe
  XP_009615390.1 284 EDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCIVRKHVERASDNLKSVITTYEGKHNHE 341
                     8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-2765133IPR003657WRKY domain
SuperFamilySSF1182904.97E-2473133IPR003657WRKY domain
SMARTSM007742.3E-3375133IPR003657WRKY domain
PROSITE profilePS5081121.57476134IPR003657WRKY domain
PfamPF031061.1E-2476132IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-34268343IPR003657WRKY domain
SuperFamilySSF1182907.32E-28276343IPR003657WRKY domain
PROSITE profilePS5081136.862278343IPR003657WRKY domain
SMARTSM007742.7E-36283342IPR003657WRKY domain
PfamPF031068.2E-25284341IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MSSPPCWPAV LTIPPGISPA ALLDSPTPTE TNVQQTLNSI ELTNKQIPQQ EEFTKKENQF  60
EQNGVFSSSI SPSSSDDGFT WRKYGQKRVK GSNFPRSYYK CTQQSCPVRK KVECAPNGQV  120
IEIVYNGAHN HPKTQSIRRP NMDNSYVIRE VEEIGQENAS VWRNQQFECN KNVISYNDNG  180
LKRTSSASVL TEVSDPMSTN PKSMNVFESA GTPELSSTLT SYDGDDGDWA TQESTLLGDD  240
VNEYELEPKR RKKESYSAEP SLLSRTVRES KVVLQVESEI DILEDGYRWR KYGQKVVKGN  300
PNPRSYYKCT NAGCIVRKHV ERASDNLKSV ITTYEGKHNH EVPTANKTNG VAGHIRSAST  360
LNGQPNCMTT RKSVKGSNCR MQVQDLPFPF ERKPFVGSEY LRPSFVGSYL GDLSFGACSL  420
QLPNFPLPLP SRMSFPARLN EPPLGDFHLN NHHLLPNGTS NSFLAVGNMQ HINDDNNNSS  480
LLKAKEEIQW T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-3376343877Probable WRKY transcription factor 4
2lex_A9e-3376343877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1247253PKRRKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2387897e-48AC238789.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 5 clone C05HBa0142A20, complete sequence.
GenBankHG9754447e-48HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755177e-48HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615390.10.0PREDICTED: probable WRKY transcription factor 4 isoform X2
TrEMBLM1C5480.0M1C548_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000600420.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.13e-74WRKY DNA-binding protein 4